PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA04G09470.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LBD
Protein Properties Length: 89aa    MW: 10422.5 Da    PI: 4.44
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA04G09470.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26046.88.4e-151524697
           DUF260 46 lkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97
                     +++lp +++ d++sslvyeA+ r+rdPvy +v+ i+ lq+q++ql+ +la  
  ONIVA04G09470.1  1 MQELPVQQQGDTVSSLVYEANDRMRDPVYDCVRAISFLQNQVSQLQMQLAIG 52
                     68999*******************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508918.758156IPR004883Lateral organ boundaries, LOB
PfamPF031957.9E-13151IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 89 aa     Download sequence    Send to blast
MQELPVQQQG DTVSSLVYEA NDRMRDPVYD CVRAISFLQN QVSQLQMQLA IGQGENLCIQ  60
MQHRDGNENE KNAREEEERE RREKREGNI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCR8551101e-144CR855110.1 Oryza sativa genomic DNA, chromosome 4, BAC clone: H0502B11, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624534.14e-42PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW32e-27LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A0E0H0B62e-59A0A0E0H0B6_ORYNI; Uncharacterized protein
STRINGBGIOSGA016336-PA1e-38(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88238150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.19e-28LBD family protein